PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43433.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 228aa    MW: 26132.7 Da    PI: 7.918
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43433.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.3e-082259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEd +l + v+ +G g          ++R++k+c++rw++yl
       KHN43433.1 22 KGPWSVEEDTILQNHVATHGDG----------LKRSGKSCRLRWLNYL 59
                     79******************99..........68999*********97 PP

2Myb_DNA-binding48.12.8e-1565108146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E+  +++++ ++G++ W++Iar+++ gRt++++k++w++
       KHN43433.1  65 RGNITLQEQITILELHSRWGNR-WSKIARHLP-GRTDNEIKNYWRT 108
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.9011759IPR017930Myb domain
SuperFamilySSF466892.3E-2420106IPR009057Homeodomain-like
SMARTSM007172.7E-52161IPR001005SANT/Myb domain
PfamPF002494.5E-72259IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-122366IPR009057Homeodomain-like
PROSITE profilePS5129422.70960114IPR017930Myb domain
SMARTSM007172.4E-1364112IPR001005SANT/Myb domain
PfamPF002491.3E-1365108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2167111IPR009057Homeodomain-like
CDDcd001676.03E-1069108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MDVNKVKKAR SIVLDCEEEI RKGPWSVEED TILQNHVATH GDGLKRSGKS CRLRWLNYLR  60
PDVRRGNITL QEQITILELH SRWGNRWSKI ARHLPGRTDN EIKNYWRTRV IKQARNLNCD  120
VDSKQFQDAL RCVWMPRLIE RIQPPLPIPS ELTHGPAHIA TSQLGPNPTA QAQHEFHGSL  180
ELNAPLDSEH HVWGACHCFN GNSTLPLGGG DLMESLWDDL EIKHNFLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-201910824122MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150374e-57AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553674.11e-167PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE18e-59MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0B2SF461e-170A0A0B2SF46_GLYSO; Transcription factor MYB21
STRINGGLYMA19G40670.21e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-65myb domain protein 112
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]